Структура белка: введение для айтишников

Приятно видеть, что хабравчане регулярно интересуется другими предметными областями – например, биологией (более конкретно – структурой и функцией биологических макромолекул). Однако некоторые посты (например, этот), вызывают у специалиста просто физическую боль из-за обилия совершенно диких фактологических ошибок. В этом посте мне хочется рассказать о структуре и функции белка. О том, что мы знаем и о том, чего не знаем, а так же об имеющихся в этой области вычислительных задачах, требующих решения и интересных IT-специалистам. Постараюсь рассказывать сжато и тезисно, чтобы информации было больше, а воды – меньше. Всех, интересующихся структурой белков, прошу под кат, там очень много букв.

1. Почему белки важны?


Как сказал Фридрих Энгельс, “Жизнь есть способ существования белковых тел”. В 19 веке еще не знали о роли ДНК в наследовании генетической информации, но утверждение дяди Фридриха в значительной мере справедливо до сих пор – основную работу в наших клетках совершают именно белки. Это и поддержание структуры (формы клеток), и химический катализ, и моторная функция (сокращение мышц, например), и транспорт (скажем, белок гемоглобин переносит кислород из легких в ткани и углекислый газ в обратном направлении) и сложные регуляторные функции по поддержанию постоянства внутренней среды (скажем, белковые гормоны и всякие внутриклеточные регуляторные системы) и многие другие. Словом, если в нашем организме что-то происходит, в это обязательно вовлечены белки (хотя и не только они).

2. Что такое белок?


С химической точки зрения белок – это линейный (неветвящийся) полимер, состоящий из монотонно повторяющихся одинаковых блоков «основной цепи», к которым приделаны различные «боковые группы». Так как блоки основной цепи несимметричны, вся полипептидная цепь белка имеет направление, различают N- и C-конец полипептидной цепи.

Длина цепи – от 70 до более чем 1000 мономеров (аминокислотных остатков), средняя длина для высших организмов – примерно 500-600 аминокислотных остатков, для бактерий эта величина будет меньше, скорее 300-400 остатков. Всего в природе существует 20 стандартных аминокислот, одинаковых и для бактерии и для человека, то есть из основной цепи могут торчать 20 разных боковых групп.

(Тут возможна поправка – некоторые химические группы могут быть модифицированны после синтеза белка, например, фосфорилированы. Однако это не рассматривается как другая аминокислота, а рассматривается как продукт модификации исходной. Так же у высших организмов возможно встраивание двух неканонических аминокислот, но это редкое событие. То есть, строго говоря, разных аминокислот 22, из них 20 основных и 2 редкие, плюс некоторые боковые группы могут быть изредка химически модифицированы).

Из поколения в поколение генетическая информация передается в виде ДНК, в ней есть так называемые «белок-кодирующие области». В этих местах ДНК однозначным образом (для ботанов – с точностью до альтернативного сплайсинга и редактирования РНК) закодирована информация о линейной последовательности аминокислот для синтеза данного белка, плюс в клетке есть соответствующие машины, способные синтезировать белок по информации, изначально закодированной в ДНК.

Так как белок – линейный полимер, собранный из 20 стандартных мономеров, его так называемую «первичную структуру» легко представить в виде строки, например так:

 
>small ubiquitin-related modifier 3 precursor [Homo sapiens]
MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQG
LSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF


Это аминокислотная последовательность маленького человеческого белка в формате FASTA, первая строчка, начинающаяся с «>», описывает его название, после чего следует последовательность аминокислот в соответствии со стандартной кодировкой (например, М –метиони, S – серин и тд, всего 20 букв стандартного однобуквенного кода), слева – N-конец белка, справа – его С-конец. Для разных белков длина строки будет очевидно разной, так как белки имеют разную длину. Последовательности всех известных белков можно найти в открытом доступе здесь: www.ncbi.nlm.nih.gov

3. Структура белка


Хорошо, с первичной структурой разобрались, но разве белок работает в развернутом линейном виде? Конечно нет. Тут надо заметить, что со структурной точки зрения есть разные классы белков: глобулярные, мембранные и фибриллярные. Мембранные белки, как следует из названия, живут только в клеточных мембранах, для стабилизации их структуры нужно особое окружение мембраны, мы не будем их рассматривать в этом обзоре. Фибриллярные белки имеют простое регулярное строение, похожи на вытянутые волокна, они не растворимы в воде и выполняют структурные функции (например, из кератина состоят волосы, к фибриллярным белкам относится белок из натурального шёлка). Недавно стали выделять класс разупорядоченных белков – белков, не обладающих постоянной трехмерной структурой, либо приобретающих ее только на короткое время при взаимодействии с другими белками. Наиболее интересный с практической точки зрения класс белков, который мы и будем рассматривать – глобулярные водорастворимые белки, к этому классу относится большинство белков.

Линейная полипептидная цепь в воде способна самопроизвольно сворачиваться в сложную трехмерную структуру (глобулу) и только в таком свернутом виде белки могут выполнять химический катализ и прочую интересную работу. Поэтому нам принципиально важно знать именно трехмерную укладку белка, так как только на этом уровне становится понятно, как белок работает.

Вопрос: сколько трехмерных структур соответствует конкретному белку?
Ответ: Одна, с точностью до небольшой подвижности маленьких «разупорядоченных» петель. Известно ровно одно исключение, когда одной последовательности соответствуют 2 достаточно разные структуры, это прионы.

Вопрос: Почему у белка только одна трехмерная структура?
Ответ: для химического катализа нам нужно расположить соответствующие химические группы строго определенным образом в пространстве. Для этого нужна жесткая структура. То есть весь белок должен быть жестким, чтобы поддерживать химические группы аминокислот активного центра в нужных местах (в реальности многие белки состоят из двух и более жестких частей, которые могут двигаться друг относительно друга, это нужно для регуляции активности белка (аллостерическая регуляция), чтобы некий сигнал мог включать и выключать химическую активность белка-фермента). Чтобы структура была жесткой и стабильной, природа позаботилась о том, чтобы структура каждого белка соответствовала энергетическому минимуму данной системы атомов и этот минимум был настолько глубоким, чтобы белок из него не «выпрыгнул». Все другие, паразитные структуры, обладают большей энергией и белок все равно сваливается в энергетический минимум, соответствующий нативной структуре.


Вопрос: на чем держится трехмерная структура белка?
Ответ: если коротко, то в основном на большом количестве нековалентных взаимодействий. В принципе, химические группы белка могут образовывать: (1) водородную связь, эти группы есть и в основной цепи и у некоторых боковых групп, (2) ионную связь – электростатическое взаимодействие между разноименно заряженными боковыми группами, (3) Ван-дер-Ваальсово взаимодействие и (4) гидрофобный эффект, на котором держится общая структура белка. Суть в том, что в белке всегда есть гидрофобные ароматические остатки, им энергетически невыгодно контактировать с полярными молекулами воды, а выгодно «слипнуться» друг с другом. Таким образом, при сворачивании белка гидрофобные группы выталкиваются из водного окружения, «слипаясь» друг с другом и формируя «гидрофобное ядро», а полярные и заряженные группы, наоборот, стремятся в водное окружение, формируя поверхность белковой глобулы. Так же (5) боковые группы двух остатков цистеина могут образовать между собой дисульфидный мостик – полноценную ковалентную связь, жестко фиксирующую белок.

Соответственно, все аминокислоты делятся на гидрофобные, полярные (гидрофильные), положительно и отрицательно заряженные. Плюс цистеины, способные образовывать ковалентную связь между собой. Особыми свойствами обладают глицин – у него отсутствует боковая группа, сильно ограничивающая конформационную подвижность других остатков, поэтому он может очень сильно «гнуться» и находится в местах, где белковую цепь надо развернуть. У пролина же, наоборот, боковая группа образует кольцо, ковалентно связанное с основной цепью, жестко фиксируя ее конформацию. Пролины встречаются там, где надо сделать белковую цепь жесткой и негнущейся. Многие заболевания связаны с мутацией пролина на глицин, из-за чего структура белка слегка «плывет».

Вопрос: откуда вообще мы знаем о трехмерных структурах белка?
Ответ: из эксперимента, это абсолютно надежные данные.
Сейчас есть 3 метода для экспериментального определения структуры белка: ядерно-магнитный резонанс (ЯМР), cryo-EM (электронная микроскопия) и рентгеноструктурный анализ кристаллов белка.

ЯМР позволяет определить структуру белка в растворе, но он работает только для очень маленьких белков (для больших невозможно сделать деконволюцию).

Этот метод был важен для общего доказательства того, что у белка только одна трехмерная структура и что структура белка в кристалле идентична структуре в растворе. Это очень дорогой метод, так как требуется получить белок с изотопными метками.

Cryo-EM заключается в простой заморозке раствора белка и микроскопии. Минус метода – низкое разрешение (видна лишь общая форма молекулы, но не видно, как она устроена внутри), плюс плотность белка близка к плотности воды/растворителя, поэтому сигнал тонет в высоком уровне шума. В этом методе активно применяются компьютерные технологии работы с картинками и статистика для вытягивания сигнала из шума.

Отбираются миллионы картинок молекул белка, проводится разделение на классы в зависимости от ориентации молекулы относительно подложки, усреднение по классам, генерация eigenimages, новый раунд усреднения и так пока не сойдется. Потом из информации из разных классов можно восстановить трехмерный вид молекулы с низким разрешением. Если же есть внутренняя симметрия частиц (например, при cryo-EM анализе вирусов), то можно еще каждую частицу поусреднять в соответствии с операторами симметрии – тогда разрешение будет еще лучше, но хуже, чем в случае рентгеноструктурного анализа.

Рентгеноструктурный анализ – основной способ определения структур белка. Главный плюс – потенциально можно получить кристаллы даже очень больших комплексов из многих десятков белков (например, именно так была определена структура рибосомы – Нобелевская премия 2009 года). Минус метода – вначале нужно получить кристалл белка, но далеко не каждый белок хочет кристаллизоваться.

Зато после того, как кристалл получен, по дифракции рентгеновского излучения можно однозначно определить положения всех (упорядоченных) атомов в молекуле белка, этот метод дает самое высокое разрешение и позволяет в лучших случаях видеть позиции отдельных атомов. Было доказано, что структура белка в кристалле однозначно соответствует структуре в растворе.

Сейчас действует конвенция – если ты определил структуру белка любым из экспериментальных физических методов, структура должна быть помещена в открытый доступ в банк данных белковых структур (Protein Data Bank – PDB, www.pdb.org ), в настоящее время там находится более 90 000 структур (впрочем, многие из них повторяющиеся, например, комплексы одного и того же белка с разными малыми молекулами, такими, как лекарственные средства). В PDB все структуры лежат в стандартном формате, называющемся, внезапно, pdb. Это текстовый формат, в котором каждому атому структуры соответствует одна строчка, в которой указан номер атома в структуре, название атома (углерод, азот и тд), название аминокислоты, в которую входит атом, название цепи белка (A, B, C и тд, если это кристалл комплекса из нескольких белков), номер аминокислоты в цепи и трехмерные координаты атома в ангстремах относительно ориджина, плюс так называемые температурный фактор и заселённость (это сугубо кристаллографические параметры).

ATOM      1  N   HIS A  17     -12.690   8.753   5.446  1.00 29.32           N  
ATOM      2  CA  HIS A  17     -11.570   8.953   6.350  1.00 21.61           C  
ATOM      3  C   HIS A  17     -10.274   8.970   5.544  1.00 22.01           C  
ATOM      4  O   HIS A  17     -10.193   8.315   4.491  1.00 29.95           O  
ATOM      5  CB  HIS A  17     -11.462   7.820   7.380  1.00 23.64           C  
ATOM      6  CG  HIS A  17     -12.551   7.811   8.421  1.00 21.18           C  
ATOM      7  ND1 HIS A  17     -13.731   7.137   8.194  1.00 28.94           N  
ATOM      8  CD2 HIS A  17     -12.634   8.384   9.644  1.00 21.69           C  
ATOM      9  CE1 HIS A  17     -14.492   7.301   9.267  1.00 27.01           C  
ATOM     10  NE2 HIS A  17     -13.869   8.058  10.168  1.00 22.66           N  
ATOM     11  N   ILE A  18      -9.269   9.660   6.089  1.00 19.45           N  
ATOM     12  CA  ILE A  18      -7.910   9.377   5.605  1.00 18.67           C  
ATOM     13  C   ILE A  18      -7.122   8.759   6.749  1.00 16.24           C  
ATOM     14  O   ILE A  18      -7.425   8.919   7.929  1.00 18.80           O  
ATOM     15  CB  ILE A  18      -7.228  10.640   5.088  1.00 20.22           C  
ATOM     16  CG1 ILE A  18      -7.062  11.686   6.183  1.00 18.52           C  
ATOM     17  CG2 ILE A  18      -7.981  11.176   3.889  1.00 24.61           C  
ATOM     18  CD1 ILE A  18      -6.161  12.824   5.749  1.00 28.21           C  
ATOM     19  N   ASN A  19      -6.121   8.023   6.349  1.00 15.46           N  
ATOM     20  CA  ASN A  19      -5.239   7.306   7.243  1.00 14.34           C  
ATOM     21  C   ASN A  19      -4.012   8.178   7.507  1.00 14.83           C  
ATOM     22  O   ASN A  19      -3.431   8.715   6.575  1.00 18.03           O  
ATOM     23  CB  ASN A  19      -4.825   6.003   6.573  1.00 17.71           C  
ATOM     24  CG  ASN A  19      -6.062   5.099   6.413  1.00 21.26           C  
ATOM     25  OD1 ASN A  19      -6.606   4.651   7.400  1.00 26.18           O  
ATOM     26  ND2 ASN A  19      -6.320   4.899   5.151  1.00 31.73           N  


Далее есть специальные программы, которые по данным из этого текстового файла могут графически отображать красивую трехмерную структуру молекулы белка, которую можно покрутить на экране монитора и, как говорил Гай Додсон, «дотронуться мышкой до молекулы» (например, PyMol, CCP4mg, старый RasMol). То есть смотреть на структуры белка просто – ставишь программу, загружаешь нужную структуру из PDB и наслаждаешься красотой природы.

4. Анализируем структуру


Итак, мы поняли основную идею: белок — линейный полимер, сворачивающийся в водном растворе под действием множества слабых взаимодействий в стабильную и единственную для данного белка трехмерную структуру, и способный в таком виде выполнять свою функцию. Различают несколько уровней организации белковых структур. Выше мы уже познакомились с первичной структурой – линейной последовательностью аминокислот, которую можно выписать в строчку.


Вторичная структура белка определяется взаимодействием атомов основной цепи белка. Как уже было сказано выше, в состав основной цепи белка входят доноры и акцепторы водородной связи, таким образом, основная цепь может приобретать некоторую структуру. Точнее, несколько разных структур (детали все-таки зависят от различающихся боковых групп), так как возможно образование разных альтернативных водородных связей между группами основной цепи. Структуры бывают такие: альфа-спираль, бета-листы (состоящие из нескольких бета-тяжей), которые бывают параллельными и анти-параллельными, бета-поворот. Плюс часть цепи может и не иметь выраженной структуры, например в районе поворота петли белка. Эти типы структур имеют свои устоявшиеся схематичные обозначения – альфа-спираль в виде спирали или цилиндра, бета-тяжи в виде широких стрелок. Вторичную структуру удается достаточно достоверно предсказывать по первичной (стандартом является JPred), альфа-спирали предсказываются наиболее точно, с бета-тяжами бывают накладки.

Третичная структура белка определяется взаимодействием боковых групп аминокислотных остатков, это и есть трехмерная структура белка. Можно представить себе, что вторичная структура сформирована и теперь эти спирали и бета-тяжи хотят уложиться все вместе в компактную трехмерную структуру, чтобы все гидрофобные боковые группы спокойно «слиплись» вместе в глубине белковой глобулы, сформировав гидрофобное ядро, а полярные и заряженные остатки торчали наружу в воду, формируя поверхность белка и стабилизируя контакты между элементами вторичной структуры. Третичную структуру изображают схематически несколькими способами. Если просто отрисовать все атомы, то получится каша (хотя когда мы анализируем активный центр белка, то мы хотим смотреть как раз на все атомы активных остатков).

Если мы хотим посмотреть, как устроен весь белок в общем, можно отобразить только некоторые атомы основной цепи, чтобы увидеть ее ход. Как вариант, можно нарисовать красивую схему, где поверх реального расположения атомов схематично нарисованы элементы вторичной структуры – так с первого взгляда видна укладка белка. После изучения всей структуры в общем, схематичном виде, можно отобразить химические группы активного центра и уже сосредоточиться на них. Задача предсказания третичной структуры белка – нетривиальная и в общем случае не решается, хотя может быть решена в частных случаях. Подробнее – ниже.

Четвертичная структура белка – да, есть и такая, правда не у всех белков. Многие белки работают сами по себе (мономеры, в данном случае под мономером имеется в виду одиночная свернутая полипептидная цепь, то есть белок целиком), тогда их четвертичная структура равна третичной. Однако достаточно много белков работает только в комплексе, состоящем из нескольких полипептидных цепей (субъединиц или мономеров — димеры, тримеры, тетрамеры, мультимеры), тогда вот такая сборка из нескольких отдельных цепей и называется четвертичной структурой. Самый банальный пример – состоящий из 4 субъединиц гемоглобин, самый красивый на мой взгляд пример – состоящий из 11 одинаковых субъединиц бактериальный белок TRAP.

5. Вычислительные задачи


Белок – сложная система из тысяч атомов, поэтому без использования компьютеров в структуре белка не разобраться. Задач, как решенных на приемлемом уровне, так и совсем не решенных, множество. Перечислю наиболее актуальные:

На уровне первичной структуры – поиск белков с похожей аминокислотной последовательностью, построение по ним эволюционных деревьев и тд – классические задачи биоинформатики. Главным хабом является NCBI — The National Center for Biotechnology Information, www.ncbi.nlm.nih.gov. Для поиска белков со сходной последовательностью стандартно используется BLAST: blast.ncbi.nlm.nih.gov/Blast.cgi

Предсказание растворимости белка. Речь идет о том, что если мы прочитаем геном какого-нибудь животного, определим по нему последовательности белков, переклонируем эти гены в кишечную палочку или baculovirus expression system, то окажется, что при экспрессии в этих системах примерно треть белков не будет сворачиваться в правильную структуру, и, как следствие, будет нерастворима. Тут выясняется, что большие белки на самом деле состоят из отдельных «доменов», каждый из которых представляет автономную, функциональную часть белка (несущую одну из его функций) и часто «вырезав» из гена отдельный домен, можно получить растворимый белок, определить его структуру и провести с ним опыты. Люди пытаются использовать машинное обучение (нейронные сети, SVM и прочие классификаторы), чтобы предсказывать растворимость белка, однако работает оно достаточно плохо (Гугл много чего покажет по запросу “protein solubility prediction” – есть много серверов, но по моему опыту все они работают отвратительно на моих белках). В идеале я хотел бы видеть сервис, который надежно сказал бы, где в белке находятся те самые растворимые домены, чтобы их можно было вырезать и работать с ними – такого сервиса нет.

На уровне вторичной структуры – предсказание той самой вторичной структуры по первичной (JPred)

На уровне третичной структуры – поиск белков со сходными трехмерными структурами (DALI, en.wikipedia.org/wiki/Structural_alignment ),
Поиск структур по заданной суб-структуре. Например, у меня есть расположение трех аминокислот активного центра в пространстве. Хочу найти структуры, которые содержать такие же три аминокислоты в таком же относительном расположении, либо найти структуры белков, мутирование которых даст возможность расположить нужные аминокислоты нужным образом. (гуглить «protein substructure search»)
Предсказание потенциальной подвижности трехмерной структуры, возможных конформационных изменений – normal mode analysis, ElNemo.

На уровне четвертичной структуры – предположим, известны структуры двух белков. Известно, что они образуют комплекс. Предсказать структуру комплекса (определить, как эти два белка будут взаимодействовать посредством shape matching, например). Гуглить «protein-protein docking»

6. Предсказание структуры белка


Выделил эту вычислительную задачу в отдельный раздел, ибо велика она, фундаментальна и не решается в общем случае.

Экспериментально мы знаем, что если взять белок, полностью развернуть его и бросить в воду, то он свернется обратно в исходное состояние за время от миллисекунд до секунд (это утверждение справедливо по крайней мере для небольших глобулярных белков без всяких патологий). Это значит, что вся информация, необходимая для определения трехмерной структуры белка, в неявном виде содержится в его первичной последовательности, поэтому так хочется научиться предсказывать трехмерную структуру белка по последовательности аминокислот in silico! Однако эта задача в общем случае не решена до сих пор. В чем же дело? Дело в том, что в первичной последовательности отсутствует в явном виде информация, необходимая для построения структуры. Во-первых, нет информации о конформации основной цепи – а она обладает значительной подвижностью, хотя и несколько ограниченной по стерическим причинам. Плюс каждая боковая цепь каждой аминокислоты может находиться в разных конформациях, для длинных боковых групп типа аргинина, это может быть больше десятка конформаций.

Что же делать? Есть достаточно известный хабравчанам самый общий подход, называемый «молекулярная динамика» и подходящий для любых молекул и систем. Берем развернутый белок, приписываем всем атомам случайные значения скоростей, считаем взаимодействия между атомами, повторяем до тех пор, пока система не придет в стабильное состояние, соответствующее свернутому белку. Почему это не работает? Потому что современные вычислительные мощности позволяют за месяцы работы кластера считать десятки наносекунд для системы из тысяч атомов, какой является белок, помещенный в воду. Время же сворачивания белка – миллисекунды и больше, то есть вычислительных мощностей не хватает, разрыв – в несколько порядков. Впрочем, пару лет назад американцы совершили некоторый прорыв. Они использовали специальное железо, оптимизированное для векторных вычислений и после оптимизации на аппаратном уровне у них за месяцы работы машины получилось посчитать молдинамику до миллисекунд для очень маленького белка и белок свернулся, структура соответствовала экспериментально определенной ( http://en.wikipedia.org/wiki/Anton_(computer) )! Однако праздновать победу еще рано. Они взяли очень маленький (его размер раз в 5-10 меньше среднего белка) и один из самых быстросворачивающихся белков, классический модельный белок, на котором изучалось сворачивание. Для больших белков время расчетов увеличивается нелинейно и потребуются уже годы, то есть еще есть над чем работать.

Другой подход реализован в Rosetta. Они разбивают последовательность белка на очень короткие (3-9 остатков) фрагменты и смотрят, какие конформации для этих фрагментов присутствуют в PDB, после чего запускают Монте-Карло по всем вариантам и смотрят, что получится. Иногда получается что-то годное, но в моих случаях через несколько дней работы кластера получаешь такой бублик, что возникает немой вопрос: «Кто писал их оценочную функцию, ставящую какую-то хорошую оценку вот этой загогулине?».

Есть инструменты и для моделирования вручную – можно предсказать вторичную структуру и попробовать вручную крутить ее, находя лучшую укладку. Некие гениальные люди даже выпустили игрушку FoldIt, представляющую белок схематично и позволяющую укладывать его, как-бы собирая головоломку (для интересующихся структурой – рекомендую!). Есть абсолютно официальное соревнование для предсказателей белковых структур, называемое CASP. Суть в том, что когда экспериментаторы определяют новую структуру белка, не имеющую аналогов в PDB, они могут не выкладывать ее сразу в PDB, а выставить последовательность этого белка на конкурс предсказаний CASP. Через некоторое время, когда все закончат свои предсказательные модели, экспериментаторы выкладывают свою экспериментально определенную структуру белка и смотрят, насколько хорошо сработали предсказатели. Самое интересное, что игроки FoldIt, не будучи учеными, как-то выиграли CASP у профессионалов моделирования белковых структур и предсказали структуру белка точнее. Однако даже эти успехи не позволяют утверждать, что проблема предсказания структуры белка решается – очень часто модель очень далека от реальной структуры.

Все это относилось к моделированию белков ab initio, когда нет никакой априорной информации о структуре. Однако очень часто бывают ситуации, когда для некоторого белка в PDB присутствует его отдаленный родственник с уже известной структурой. Под родственником подразумевается белок с похожей первичной последовательностью. Считается, что для белков со сходством по первичной последовательности больше 30% одинаковая укладка основной цепи (хотя одинаковая укладка наблюдалась и для белков, не проявляющих никакого статистически достоверного сходства по первичной последовательности). В случае наличия гомолога (похожего белка) с известной структурой, можно сделать «гомологичное моделирование», то есть попросту «натянуть» последовательность твоего белка на известную структуру гомолога, а потом погонять минимизацию энергии, чтобы как-то все это дело утрясти. Такое моделирование показывает хорошие результаты при наличие очень близких гомологов, чем дальше гомолог – тем больше ошибка. Инструменты для гомологичного моделирования – Modeller, SwissModel.

Можно решать и другие задачи, например, пытаться моделировать, что произойдет, если внести в белок ту или иную мутацию. Например, если заменить гидрофильную аминокислоту на поверхности белка на другую гидрофильную, то скорее всего структура белка не изменится вообще. Если заменить аминокислоту из гидрофобного ядра на другую гидрофобную, но другого размера, то скорее всего укладка белка останется той же, но слегка «съедет» на доли ангстрема. Если же заменить аминокислоту из гидрофобного ядра на заряженную, то скорее всего белок просто «взорвется» и не сможет свернуться.

Может показаться, что все не так уж и плохо и мы достаточно хорошо пониманием сворачивание белка. Да, мы понимаем кое-что, например до некоторой степени мы понимаем общие физические принципы, лежащие в основе сворачивания полипептидной цепи – они рассматриваются в замечательном учебнике Птицына и Финкельштейна «Физика белка». Однако это общее понимание не позволяет нам ответить на вопросы «Свернется ли данный белок или не свернется?», «Какая структура будет у этого белка?», «Как сделать белок с желаемой структурой?».

Вот одна из иллюстраций: мы хотим локализовать один из доменов большого белка, это стандартная задача. У нас есть фрагмент, который сворачивается и растворим, то есть это живой и здоровый белок. Мы же хотим найти его минимальную часть и начинаем методами генетической инженерии с обоих концов удалять по 2-3 аминокислоты, экспрессировать такой обрезанный белок в бактерии и смотреть его сворачиваемость экспериментально. Мы делаем десятки конструкций с такими маленькими делециями и видим такую картину – полностью растворимый и живой белок отличается от полностью мертвого и несворачивающегося на 3 аминокислоты. Повторюсь, это объективный экспериментальный результат. Проблема в том, что сейчас не существует вычислительного метода, который предсказал бы сворачиваемость белка хотя бы на уровне «да/нет» и сказал мне, где проходит граница между сворачивающимся и несворачивающимся белком, потому мы вынуждены клонировать и экспериментально проверять десятки вариантов. Это лишь одна из иллюстраций того, что наше понимание структуры белка весьма далеко от совершенства. Как говорил Ричард Фейнман, «Чего не могу воссоздать, того не понимаю».

Так что, господа программисты, физики и математики, нам еще есть над чем работать.

На этой оптимистичной ноте разрешите откланяться, благодарю всех, кто осилил сей опус.

Для глубоко знакомства с предметной областью рекомендую следующий минимум:
1) «Физика белка» Птицын и Финкельштейн. Большую часть материала Алексей Витальевич Финкельштейн выложил в онлайн, чем и рекомендую с благодарностью воспользоваться: phys.protres.ru/lectures/protein_physics/index.html (а я утащил оттуда несколько картинок)
2) Патрушев, «Искусственные генетические системы», особенно часть II «Белковая инженерия». Есть на торрентах в формате Djvu
3) Для информации, опубликованной в биологических научных журналах, есть официальный поисковик PubMed ( www.pubmed.org ) — у него стоит попросить почитать про «protein engineering» и тому подобное.
Поделиться публикацией

Комментарии 72

    –34
    Заранее, спасибо! Статью чуть позже, но обязательно прочту!
      +18
      держите нас в курсе! :)
        0
        Ой, заминусовали, не ожидал. Собственно комментарий был оставлен, потому что перед сном мог не осилить, хотя бегло пробежав понял что статья интересная. В общем так и есть, многое узнал, еще раз спасибо!

        По сути, лично мне кажется главное решение так и останется в вычислительной мощности.
        И если можно вопрос, правильно ли я понял, что даже если вычислительных мощностей хватит для вычисления структуры не маленьких белков, то скорее всего этот результат будет все равно приближенным?
          0
          Пожалуйста, рад, что статья понравилась, я не минусовал :)

          Предполагается, что если делать молекулярную динамику с правильными force fields, то должно свернуться в нативную (природную) конформацию. Proof of principle: The protein was initially configured in a fully extended state and was observed to fold to a stable conformation with a backbone root-mean-squared deviation (RMSD) of ~1 Å from the crystal structure. (с) www.sciencemag.org/content/330/6002/341.full?ijkey=s.yjp.RDsEAFk&keytype=ref&siteid=sci (RMSD в 1 ангстрем — это точно правильная структура, в пределах обычных флуктуаций белковой цепи)
            0
            Это хорошо.

            А если решение задачи в будущем станет тривиальной, станет ли человек Богом? :-)
              +1
              Нет, от решения данной конкретной задачи человек Богом не станет, не бойтесь :) Так как нужно понять устройство живого на более высоких уровнях — на уровне клетки и тд. Разобраться, как все-таки мозг работает и так далее.
              А для обОжения надо, по слову отцов, Духа Святого стяжать!
        –3
        Занимательно!
        но очень сложно и серьезно. А ведь так и просится смайлик после «Почему бéлки важны?» :)
          +3
          В самом начале не просто так было предупреждение о том, что много букв ;)

          Про бЕлок — рассказывали байку про то, как биологи из Пущино приехали в гости к физикам в Дубну, а у них там в парке табличка «Берегите белок!», пущинцы конечно же прочитали неправильно и удивлялись, почему физиков так волнует сохранность белкА :)
            +2
              +10
              А вот вам не байка. На сайте РАН институт белка долгое время был переведен как «Squirrel institute».
                +1
                Было дело, правда.

                Кстати, там выше я ссылался на лекции А.В. Финкельштейна по физике белка, он в том самом Институте белка работает.
                В Пущино про БелОк (а это самый продвинутый институт там) много шуток. Например, «Чудесный город Пущино: магазин Зайчик, институт БЕлка» :)
            +2
            Фенилаланин — всегда интересовало, что же это за слово такое на этикетке лимонада)
              +9
              «Содержит фенилаланин» пишут для больных фенилкетонурией, у них в организме не расщепляется до конца фенилаланин, накапливаются вредные промежуточные продукты расщепления и человеку становится совсем плохо. У здоровых людей проблем с этим нет :)
                0
                Это подсластитель.
                0
                Спасибо! Очень интересно и до некоторой степени понятно для неспециалиста. А какой принцип использует программы для локальной оптимизации структуры, molecular dynamics или что-то более хитрое?
                  +1
                  Пожалуйста! «до некоторой степени понятно» — хм, это вежливое «не очень понятно»? :) Я старался сфокусироваться на важных вещах, чтобы было от чего оттолкнуться и начать копать глубже.

                  Для уменьшения объема вычислений, насколько я в курсе, зачастую не считают полноценную молекулярную динамику, а делают «минимизацию энергии» своими фирменными алгоритмами. В реальности это означает, что текущая позиция оценивается, скажем, по количеству «плохих» контактов, то есть когда расстояние между атомами меньше Ван-дер-Ваальсового, и подобным критериям, а потом структура слегка двигается для оптимизации по этим критериям (отличие от молдинамики в том, что двигают не отдельные атомы, а большие группы атомов, соответствующих аминокислотам и тд). Заодно алгоритм может перебрать стандартные конформации боковых групп, чтобы посмотреть, какая из них лучше «вписывается» и тд.
                    +1
                    На хим.факе даже если минимизировать мол.механикой, могут обидеться. Кар-парринелло всякие надо хотя бы. К тому же, минимизацию энергии системы с адренорецептором (к примеру) — это 60к атомов — громакс выполняет часов за 5 на домашнем ноуте.
                    Вообще говоря, крутить группы — гиблое дело. Лучше не изобретать велосипед — использовать структуру из базы данных (при наличии) или пытаться построить по аналогии+ с учетом каких то специфичных вещей для отдельных остатков
                      +1
                      хм, это вежливое «не очень понятно»? :)

                      Напротив — стала понятна задача, и почему ее тяжело решить, хотя химией после школы не занимался.
                      Еще понятно, что функцию поля для нее я никогда не напишу. :)
                        +1
                        Мы в свое время занимались минимизацией энергии «двиганием» элементов вторичной структуры (очень похоже на FoldIt, только в автоматическом режиме). Вся хитрость в том — в каких потенциалах считать, чем точнее потенциал, тем больше мерность пространства, в котором надо делать минимизацию => объем вычислений. Соответственно чтобы за разумное (конечное) время проветси расчеты — приходится упрощать модель. Даже кое-каких интересных результатов удалось добиться, с точки зрения алгоритмов.
                          0
                          Интересно! Результаты где-нибудь опубликованы? Вы использовали что-то типа shape matching или оно по-другому работало?
                            0
                            Ага, похоже на Shape Matching. Сначала рассчитывали «упругость» отдельных элементов вторичной структуры по-честному — MD, потом гнули их. По публикации не знаю, я потом другой темой занялся — МД льдоподобных структур воды (связанная вода, например), а потом и вовсе из науки ушел, к сожалению. А то чем у нас фолдинговая группа занималась уж больно на шаманство похоже было, да и сыро очень, так что думаю, что публикаций особо не было =)
                              0
                              Понятно, спасибо! Если не секрет, это где происходило?
                                0
                                Не секрет — физфак МГУ/институт белка Пущино
                                  0
                                  Знакомые все лица :) Я сам в Пущино кандидатскую делал, только не в белке, а в микре (ИБФМ РАН).
                                  Просто подумал, может где-то еще в нашей необъятной Родине фолдингом белка занимаются, ан нет.
                                    0
                                    Ну, с точки зрения биофизики/физхимии Родина не столь уж и необъятна :-) 5-6 серьезных институтов в дефолт-сити и вокруг, вот собственно и все.
                                      0
                                      Да, именно так. Хотя я видел людей из Питера и Новосиба, утверждающих, что и у них есть биохимия и молекулярка :)
                                      • НЛО прилетело и опубликовало эту надпись здесь
                                          0
                                          Смайлик в конце моего поста как-бы намекал на его ироничность :)
                                          Просто в Москве/подмосковных наукоградах на самом деле сконцентрировано большое количество интеллектуальных ресурсов, поэтому у людей, работающих в Москве/подмосковье, складывается впечатление, что больше в России науки нигде нет. А она, как Вы верно заметили, немножко есть.
                                          Под Новосибом есть даже синхротрон, на нем была первая в Советском Союзе синхротронная станция для сбора дифракционных данных с белковых кристаллов.
                            0
                            ага, мы примерно этим же занимались и тоже в автоматическом режиме. Выделяли в т.ч. закономерности вторичных структур и накладывали доп. ограничения.
                          +1
                          Да, к сожалению, подходы, работающие у химиков для малых молекул (для биологов все, что меньше ~500 Дальтон — малая молекула), перестают эффективно работать для макромолекул (15-150 и больше килоДальтон) из-за вычислительной сложности. Приходится изобретать гиблые, но более быстрые костыли.
                          Это, кстати, отдельный вопрос — сколько проблем может быть решено просто увеличением доступной вычислительной мощности. Похоже, что фолдинг белка — одна из таких проблем.
                            0
                            Учитывая нелинейный рост времени расчёта для больших белков, традиционное увеличение доступной мощности вряд ли является панацеей. Может быть, в будущем найдутся какие-то более новые и более скоростные вычислительные подходы — например, те же расчёты, но с использованием квантовых алгоритмов.
                              +1
                              Насколько я помню, химики по-честному (численным решением Шредингера) что-то порядка 1000 атомов уже считают за очень разумные времена (часы). Так что хорошо спроектированный узкоспециализированный суперкомпьютер должен эту проблему снять лет через 10-15.
                              –2
                              Крутость этого поста просто зашкаливает.
                                +5
                                Вопрос: на чем держится трехмерная структура белка?
                                Ответ: если коротко, на большом количестве слабых взаимодействий.

                                Аж сердце ёкнуло. Прочитал дальше — фух, картина мира на месте, взаимодействия электромагнитные, а не слабые. :)

                                В физике термин «слабое взаимодействие» (как и «сильное») имеет вполне определенное значение, может, как-то поправить этот кусок?
                                  0
                                  Спасибо! Уже поправил на «в основном на большом количестве нековалентных взаимодействий». Просто я использовал наш жаргонизм «слабое взаимодействие», как противоположность ковалентной связи.
                                  0
                                  Судя по количеству и соотношению комментарии / добавление в избранное, очень много людей решили почитать статью попозже.
                                    0
                                    В избранное часть добавляешь, если хочешь вернуться и перечитать, или показать кому-то при случае.
                                    +1
                                    Я перечитал статей о программировании. Прочитав заголовок ожидал нестандартную структуру данных «белка», думал с воображаемым колесом это как то связанно.
                                      +2
                                      Отличная статья! Кратко, информативно, и выделены ключевые моменты — нерешенные вычислительные задачи, именно для айтишников. Даже залогинился, чтобы плюсануть. А еще заинтересовался, как именно белки выполняют всю эту работу в живых организмах и почему именно белки, какие ключевые свойства белков заставили именно их быть «рабочими лошадками».
                                        0
                                        Меня заинтересовал вопрос — как можно понять свойства белка по его структуре? И наоборот, как предсказать структуру белка, которая будет соответствовать каким-то желаемым свойствам?
                                          +2
                                          Вопрос первый — в общем случае, не имея дополнительной информации — никак :) В реальности алгоритм такой — можно поискать гомологичные (сходные по первичной последовательности) белки, узнать, что они делают и от этого оттолкнуться. Если есть структура — такой же поиск структурных гомологов, может дать ответ на вопрос, но подтвердить функцию белка можно только в лаборатории, экспериментально. Далее, если нет гомологов с известной функцией, можно провести анализ окружения гена, кодирующего данный белок, в ДНК. Очень часто гены белков, участвующих в разных стадиях одного процесса, находятся на ДНК рядом (у бактерий это называется оперон), так можно хоть процесс определить. Если же совсем ничего не ясно, в бой идет тяжелая артиллерия — генетическая инженерия. Для начала обычно просто убивают нужный ген и смотрят, какой процесс в организме сломался, потом возможен более тонкий анализ мутантных версий белка и тд :)
                                          Плюс возможный всякие скрининги — например, если есть подозрение, что белок взаимодействует с другими белками, можно прогнать Yeast 2 hybrid system и идентифицировать возможных партнеров, далее раскручивать от них.

                                          Второй вопрос: стопроцентно — никак. Но можно предположить, как именно должны быть расположены атомы активного центра для осуществления нужной функции, а потом попытаться найти подходящий остов белка, который сможет поддерживать нужную структуру атомов активного центра. Сейчас это на уровне шаманства, люди меняли специфичности отдельных ферментов успешно и тд, но такая инженерия (успешная) — пока очень большая редкость.
                                            0
                                            Для начала обычно просто убивают нужный ген и смотрят, какой процесс в организме сломался

                                            А как это делают?
                                            Нужно ведь найти нужный ген из миллиардов(или сколько их там) нуклеотидов и повредить только нужные.
                                        +1
                                        Спасибо! Вопросы глубокие и точного ответа не имеющие, но в контексте эволюционной теории самой разумной отговоркой будет, что «так случайно получилось, а потом закрепилось». На самом деле аминокислоты могут спонтанно образоваться из неорганики (те самые опыты Миллера — http://ru.wikipedia.org/wiki/Эксперимент_Миллера_—_Юри ), плюс аминокислоты умеют даже спонтанно полимеризоваться в короткие пептиды в присутствии ионов меди. То есть их химия, скорее всего, оказалась самой «удобной» для эволюции, но точней ответить вряд ли можно. Репертуар боковых остатков аминокислот достаточно богат и позволяет катализировать множество реакций, но возникает вопрос, почему именно эти 20 аминокислот закрепились эволюцией? Ведь химически возможно существование бОльшего количества аминокислот, просто Природа не использует их в белках. Лучший ответ — так случайно получилось, то есть мы не знаем. Сторонники «intelligent design» немедленно указали бы, что здесь имеется лазейка для существования Творца. В плане же инженерии белка, сейчас поставлена такая задача — сделать искусственную систему трансляции, которая позволила бы включать в белки нестандартные аминокислоты, существенно расширяя каталитический репертуар белков. Первые успехи и proof of principle уже есть: www.nature.com/nature/journal/v464/n7287/full/nature08817.html
                                          0
                                          Есть еще хороший спор о курице и яйце — РНК и аминокислотная последовательность (особенно в свете экспериментов, показавших принципиальную возможность обратной трансляции РНК из аминокислотной последовательности). Тоже загадка из загадок, связанная с уникальной функцией белка.
                                            0
                                            Так, а вот про обратную трансляцию можно поподробней? В официальной мэйнстримной науке вроде бы до сих пор этот процесс считается невозможным, отсюда и вера в идею «мира РНК».
                                              0
                                              Вот, довольно старая статья, которая по-моему не получила продолжения, но механизм возможной обратной трансляции вполне правдоподобен. Не знаю, были ли сделаны кем-то проверочные эксперименты, но тема, как мне кажется, перспективная.

                                              Хотя, конечно, это сильно неофициальная точка зрения. С другой стороны, с точки зрения физики и химии процесса трансляции, я не вижу ни одной причины, почему не может существовать обратного механизма, так же как есть обратная транскрипция (ретровирусы, те же).
                                                0
                                                Поправка, на коротких последовательностях, конечно. Потому что обратная трансляция не денатуририванного сфолденного белка, конечно, вряд ли получится, но ведь и самопроизвольная полимеризация аминокислот пока только на коротких цепочках была показана, так что есть все шансы увидеть когда-нибудь и механизм Белок->РНК
                                                  0
                                                  Да, обратная трансляция — это полная эзотерика, официально ее нет. Есть несколько линий доказательства, почему обратная трансляция невозможна. Во-первых, функции значительного количества белков известны и такого фермента не обнаружено. Глядя на рибосому, делающую прямую трансляцию и весящую больше трех мегадальтон, 52 белка плюс длинные РНК, невольно предполагаешь, что обратную транскрипцию будет делать такая же махина и не заметить ее очень сложно. Во-вторых, синтез белка — многоступенчатый процесс, поэтому он термодинамически не может быть обращен, в отличие от одноступенчатых реакций (к которым, например, относится транскрипция — химически там образуется лишь фосфодиэфирная связь между нуклеотидами, реакция может быть легко обращена). Были еще какие-то свидетельства, которые нам читали, но уже плохо помню — давно это было :)
                                          0
                                          Спасибо за увлекательную статью!

                                          __________________
                                          Что же делать? Есть достаточно известный хабравчанам самый общий подход, называемый «молекулярная динамика» и подходящий для любых молекул и систем. Берем развернутый белок, приписываем всем атомам случайные значения скоростей, считаем взаимодействия между атомами, повторяем до тех пор, пока система не придет в стабильное состояние, соответствующее свернутому белку. Почему это не работает? Потому что современные вычислительные мощности позволяют за месяцы работы кластера считать десятки наносекунд для системы из тысяч атомов, какой является белок, помещенный в воду.
                                          ___________________

                                          Почему-то сразу же на ум приходит CUDA: 3 000 ядер на одной видеокарте! до 3-х слотов в материнке.
                                          Т.е. в принципе, можно на каждое ядро повесить по атому и посмотреть что будет.
                                            0
                                              0
                                              (Задумчиво) А он считает взаимодействие всех атомов со всеми, или как-то бьет их по группам?
                                              Я, к примеру, когда считал замерзание воды, считал по кубам пространства
                                                0
                                                Достоверно не знаю, но, похоже, что все со всеми. Глядя на видео, трудно представить, что можно угадать, какие
                                                атомы останутся достаточно далекими. А динамически обновляемый proximity усложняет обработку на конвейeре GPU.
                                                Потом, межатомные взаимодействия хоть и ослабевают с расстоянием, но все равно остаются. Исключение из модели «слабых» взаимодействий искажает поле. А, поскольку интегрировать нужно с фемтосекундным шагом до миллисекунд, есть риск получить откровенную ересь.

                                                  0
                                                  Блин, это действительно надо писать и пробовать…
                                                  так, с ходу, попробовал предложить две модели упрощенного расчета, но понял, что тут надо самому сперва попробовать. потому что, в итоге, вполне себе может оказаться правильным какой-то третий вариант, который пока и в голову не приходит.
                                            0
                                            А были попытки cкомбинировать молекулярную динамику с кинематической моделью: рассматривать спирали и тяжи как жесткие элементы, а остальные атомы по отдельности? Что-то мне подсказывает, что это и есть вышеупомянутые гиблые костыли, но вдруг…
                                              0
                                              Да, именно так «минимизация энергии» и делается. Подходы в деталях отличаются, но суть в том, что ты уже двигаешь группы атомов, в том числе и расширенные до целого элемента вторичной структуры. Проблема тут в том, что при таком приближении система обычно сползает до ближайшего локального энергетического минимума, который совсем не есть глобальный минимум. Выпрыгнуть же из локального минимума такой подход пока не может, в этом вся проблема…
                                              0
                                              Были =) Костыли и шаманство…
                                              • НЛО прилетело и опубликовало эту надпись здесь
                                                  0
                                                  В статье было написано так:

                                                  Длина цепи – от 70 до более чем 1000 мономеров (аминокислотных остатков), средняя длина для высших организмов – примерно 500-600 аминокислотных остатков, для бактерий эта величина будет меньше, скорее 300-400 остатков.


                                                  Каждая аминокислота состоит из от 10 до почти 30 атомов, включая атомы водорода. То есть в среднем в белке несколько тысяч атомов, в крупных может быть больше десятка тысяч.

                                                  Если же запускать молекулярную динамику, то белок обычно помещают в «коробочку» из воды, так как взаимодействие с водой критично для белка (хотя раньше и в «вакууме» гоняли, но поняли, что это не кошерно). Соответственно, молдинамика в таких случаях еще должна все атомы воды просчитывать.
                                                  • НЛО прилетело и опубликовало эту надпись здесь
                                                      0
                                                      Эээ, батенька, тут главный вопрос — в каком приближении считать. Т.к. если считать все честно, то на каждый шаг надо обсчитать как минимум С(n,k)=C(10^6, 2) взаимодействий, т.к. даже сильно удаленные друг от друга атомы все равно оказывают друг на друга влияние, а следовательно — влияние на энергию системы. Это отнюдь нетривиальная задачка.

                                                      Собственно все танцы с бубном в фолдинге и развернуты вокруг того, как бы считать поменьше взаимодействий, чтобы получить рабочую модель реальной молекулы. Современных вычислительных ресурсов хватает на полноценный (неупрощенный) обсчет примерно 10^3 атомов, а сложность расчетов растет нелинейно от кол-ва атомов, поэтому до появления работающих квантовых суперкомпьютеров ждать, что задачка будет решена брутфорсом не стоит.
                                                      • НЛО прилетело и опубликовало эту надпись здесь
                                                    • НЛО прилетело и опубликовало эту надпись здесь
                                                        0
                                                        Существуют и тепловая, и холодовая денатурация (разрушение структуры) белка, они возникают за счет разных эффектов. Если на пальцах, то тепловая денатурация происходит из-за разрушения водородных связей при повышении температуры, подвижность возрастает и белок разворачивается. Обычно белки денатурируют в диапазоне ~50-70 градусов Цельсия, так называемые термостабильные белки выдерживают и более высокие температуры, до 90-110 градусов. Холодовая денатурация — за счет изменения свойств воды при понижении температуры, гидрофобный эффект ослабляется при низких температурах и может привести к разворачиванию белка. Для большинства белков температура холодовой денатурации ниже 0 по Цельсию, то есть белок еще не успевает денатурировать, а раствор уже замерзает. Для некоторых же белков холодовая денатурация наблюдалась экспериментально. Подробности про сворачивание и температуру здесь: phys.protres.ru/lectures/protein_physics/l16.html
                                                    0
                                                    Олег, заинетересовало растворимость в воде и сворачиваемость белка — это одно и тоже? То есть расворим — это всегда сворачиваемый и наоборот?
                                                    И еще, правильно ли я понимаю, что несворачиваемый белок не может выполнять никакой функции и соответственно мертвый?
                                                      0
                                                      Первый вопрос — в первом приближении, да, именно так, во всяком случае это скоррелированные параметры. Если белок растворим и не выпадает в осадок — это хороший знак, он свидетельствует, что белок скорее свернут, чем нет (но не гарантирует, особенно для больших белков — часть белка может свернуться, а часть — нет). Если белок нерастворим — скорее всего, не смог свернуться. Тут все дело в гидрофобных остатках — в свернутом белке они «спрятаны» внутри глобулы, где формируют гидрофобное ядро, а снаружи глобулы — гидрофильные и заряженные группы, обеспечивающие растворимость (в общем случае). Если белок не смог свернуться, то гидрофобные остатки могут торчать наружу, «слипаться» с торчащими наружу аналогичными остатками других молекул белка, вызывая массивную аггрегацию и выпадение в осадок. Как-то так, но из любого правила могут быть исключения.

                                                      Второй вопрос — раньше именно так и считалось, однако сейчас потихоньку приходит понимание, что есть «intrinsically disordered proteins» — разупорядоченные белки, не имеющие выраженной трехмерной структуры и при этом выполняющие свои функции. Такие белки не могут быть ферментами, выполняющими катализ (для катализа нужна четкая структура), но они часто участвуют в белок-белковых взаимодействиях и регуляции клеточных процессов. Дело в том, что для связывания с другим белком структура не очень важна, так как структурированный белок может распознавать и связывать кусок несвернутого белка-партнера (BRCT domain, например). В свою очередь, на несвернутом белке могут быть сайты распознавания для нескольких разных структурированных белков и он может служить «затравкой» для образования биологически важного комплекса из нескольких белков. Связывание структурированных белков с неструктурированным, в свою очередь, может регулироваться белками-регуляторами за счет фофсорилирования неструктурированного белка, например.
                                                        0
                                                        Спасибо за ответы! Из твоих ответов, я понял, что я не до конца понимаю, что значит раствориться. Чисто на бытовом уровне, как понимаю — это состояние из кторого белок не выпадает в осадок со временем. Наверно так.
                                                          0
                                                          В принципе, все правильно.
                                                          В практическом плане это выглядит так — белок же не берется сам по себе с потолка, его продуцируют в бактериях или культуре эукариотических клеток, в которые засунут ген нужного белка так, чтобы бактерия или клетка вырабатывала его в больших количествах (по-научному — ген под контролем сильного промотора). Соответственно, в какой-то момент у нас есть несколько грамм бактерий, собранных после выращивания в паре литров среды. Мы эти бактерии суспендируем в некотором растворе и разрушаем их клеточную стенку и мембраны ультразвуком или специальным прессом (грубо говоря, клетки лопаются). В результате имеем растворимую фракцию белков и прочего клеточного содержимого плюс «осколки» клеток, которые нерастворимы. Растворимое отделяется от нерастворимого центрифугированием, а потом смотришь — есть ли твой белок в растворе или он находится вместе с осколками клеток в нерастворимом осадке. Обычно считается, что если белок не растворим, значит по какой-то причине он не смог свернуться, хотя реально никто не знает, в чем там точно дело. Как-то так. Причем хитро перебирая компоненты раствора иногда удается растворить нерастворимый белок. Но редко :(
                                                          Для проведения экспериментов, как Вы понимаете, нужен растворимый, функционально активный белок…
                                                            0
                                                            Да, тут есть еще тонкий момент: химический раствор у ученых в пробирке — это совсем не то, что среда внутри живой клетки. Например, внутри живой клетки фактически нет свободных молекул воды, а в растворе их полно. Поэтому возможна такая ситуация, когда белок в естественных условиях синтезируется в количестве две-три молекулы на всю клетку и в таких условиях он прекрасно сворачивается и работает. Однако если мы запустим суперпродукцию белка (нужный белок будет составлять 5-50% от всех белков клетки по массе), то белок не будет успевать сворачиваться, плюс ему будет плохо в условиях раствора в пробирке и он обидится и выпадет в осадок. Справедливости ради стоит отметить, что большинство белков счастливы и растворимы и после суперпродукции, и после переноса их из клетки в химический раствор. Как-то так. Уффф…
                                                      0
                                                      Очень круто, что публикуете статьи по медицине, биологии, химии на IT-ресурсе.
                                                      Вот потрясающая статья с наглядными картинками о молекулах РНК. (там их полно подобных задач-историй)
                                                      elementy.ru/problems/624

                                                    Только полноправные пользователи могут оставлять комментарии. Войдите, пожалуйста.

                                                    Самое читаемое